PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29983.m003158
Common NameLOC8269152, RCOM_1173370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family SBP
Protein Properties Length: 198aa    MW: 22529.6 Da    PI: 9.6878
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29983.m003158genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.84.8e-4175152178
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    +Cq+e+C adl++ak yhrrhkvCe h+ka+ vlv+g++qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk+++
  29983.m003158  75 CCQAEKCMADLNDAKPYHRRHKVCEYHAKAQIVLVAGIRQRFCQQCSRFHELIEFDETKRSCRRRLAGHNERRRKNTT 152
                    6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.8E-3270137IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.51373150IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-3774154IPR004333Transcription factor, SBP-box
PfamPF031102.3E-3176149IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MEGKGKQKMM MMMGRVVKEE LAHEIDRELS DDDEYLGMGN LGGDFESNKK KKVVSGDAGG  60
RKKGSFGGGG VGMRCCQAEK CMADLNDAKP YHRRHKVCEY HAKAQIVLVA GIRQRFCQQC  120
SRFHELIEFD ETKRSCRRRL AGHNERRRKN TTESHTEGSS HRGTGTQLKD MVFGQVDDSG  180
RIKITIQENT TYKHFQIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-3767149284squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002517882.11e-145PREDICTED: squamosa promoter-binding protein 1
SwissprotQ9S7A99e-45SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLB9RVW31e-145B9RVW3_RICCO; Squamosa promoter-binding protein, putative
STRINGVIT_12s0028g03350.t017e-71(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.26e-45squamosa promoter binding protein-like 4